Request QuoteCatalog Number: xP423606STJSize: 0.2-1mg

Request Quote

Recombinant UPF0345 protein Spro_1026 (Spro_1026)

Recombinant UPF0345 protein Spro_1026 (Spro_1026) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP423606STJYeast1mgQuote
EP423606STJE. coli1mgQuote
BP423606STJBaculovirus200ugQuote
MP423606STJMammalian Cell200ugQuote

Protein Information

SpeciesSerratia proteamaculans (strain 568)
UniProt IDA8GAJ0
Gene NameLocus:Spro_1026
Protein NameUPF0345 protein Spro_1026
Region Expressed1-96
Expression Tag6xHis
Purity>90%
AA SequenceMLKVNEYFAGKVKSIGFDSSSIGLTSVGVMEEGEYTFTTALPEEMTVITGALKVLLPGSP DWQVFMPGEKFFVPAHSEFNLQVADATAYLCRYLSK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review