Request QuoteCatalog Number: xP425847STPSize: 0.2-1mg

Request Quote

Recombinant UPF0345 protein Spea_3668 (Spea_3668)

Recombinant UPF0345 protein Spea_3668 (Spea_3668) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP425847STPYeast1mgQuote
EP425847STPE. coli1mgQuote
BP425847STPBaculovirus200ugQuote
MP425847STPMammalian Cell200ugQuote

Protein Information

SpeciesShewanella pealeana (strain ATCC 700345 / ANG-SQ1)
UniProt IDA8H8U2
Gene NameLocus:Spea_3668
Protein NameUPF0345 protein Spea_3668
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMLAVNEYFEGQVKSISFAGADKPASVGVMEAGEYEFGTAAPEVMQVISGALTVLLPGQAE WQTFSAGEQFDVIGDAKFQVKVATQTAYLCIYG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review