Request QuoteCatalog Number: xP461387DZSSize: 0.2-1mg

Request Quote

Recombinant UPF0345 protein RALTA_A2537 (RALTA_A2537)

Recombinant UPF0345 protein RALTA_A2537 (RALTA_A2537) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP461387DZSYeast1mgQuote
EP461387DZSE. coli1mgQuote
BP461387DZSBaculovirus200ugQuote
MP461387DZSMammalian Cell200ugQuote

Protein Information

SpeciesCupriavidus taiwanensis (strain R1 / LMG 19424) (Ralstonia taiwanensis (strain LMG 19424) )
UniProt IDB3R6D5
Gene NameLocus:RALTA_A2537
Protein Name
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMEVSQFDNVSVVKKANLYFDGKCVSHTVLFPDGTRKTLGVIFPASLTFNTGAAEIMEINA GTCRVRLAGSEDWQAYGAGQQFSVPGNSSFDIEVQETLDYVCHFE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review