Request QuoteCatalog Number: xP422162CWSSize: 0.2-1mg

Request Quote

Recombinant UPF0345 protein CKO_02780 (CKO_02780)

Recombinant UPF0345 protein CKO_02780 (CKO_02780) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP422162CWSYeast1mgQuote
EP422162CWSE. coli1mgQuote
BP422162CWSBaculovirus200ugQuote
MP422162CWSMammalian Cell200ugQuote

Protein Information

SpeciesCitrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
UniProt IDA8AK73
Gene NameLocus:CKO_02780
Protein NameUPF0345 protein CKO_02780
Region Expressed1-94
Expression Tag6xHis
Purity>90%
AA SequenceMLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGEYAFSTAAPEEMTVVSGALNVLLPGET EWKVYAAGEVFNVPGQSEFHLQVAEPTSYLCRYL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review