Request QuoteCatalog Number: xP490388LPWSize: 0.2-1mg

Request Quote

Recombinant UPF0344 protein LMHCC_0278 (LMHCC_0278)

Recombinant UPF0344 protein LMHCC_0278 (LMHCC_0278) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP490388LPWYeast1mgQuote
EP490388LPWE. coli1mgQuote
BP490388LPWBaculovirus200ugQuote
MP490388LPWMammalian Cell200ugQuote

Protein Information

SpeciesListeria monocytogenes serotype 4a (strain HCC23)
UniProt IDB8DF46
Gene NameLocus:LMHCC_0278
Protein NameUPF0344 protein LMHCC_0278
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMWGYIHLISWVAIVVLTVTALLIYSKSVKSFTMLQMINRVFYILVILSGIMMVKYSIEQS WILAIFKILMGIIVIGVVEMLLSYRKQQKPTGMFLMIFVIVVVITISLGFYLSGGYPLFN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review