Request QuoteCatalog Number: xP428274SUMSize: 0.2-1mg

Request Quote

Recombinant UPF0342 protein USA300HOU_1838 (USA300HOU_1838)

Recombinant UPF0342 protein USA300HOU_1838 (USA300HOU_1838) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP428274SUMYeast1mgQuote
EP428274SUME. coli1mgQuote
BP428274SUMBaculovirus200ugQuote
MP428274SUMMammalian Cell200ugQuote

Protein Information

SpeciesStaphylococcus aureus (strain USA300 / TCH1516)
UniProt IDA8YY15
Gene NameLocus:USA300HOU_1838
Protein NameUPF0342 protein USA300HOU_1838
Region Expressed1-114
Expression Tag6xHis
Purity>90%
AA SequenceMAVNLYDYANQLEQALRESEEYKAIKEAFANVKANEESKKLFDEFRETQINFQQKQMQGE EIAEEDLQKAQEQAQAIEKDENISALMNAEQKMSQVFQEINQIIVKPLDEIYAD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review