Request QuoteCatalog Number: xP499533FMJSize: 0.2-1mg

Request Quote

Recombinant UPF0342 protein SZO_10960 (SZO_10960)

Recombinant UPF0342 protein SZO_10960 (SZO_10960) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP499533FMJYeast1mgQuote
EP499533FMJE. coli1mgQuote
BP499533FMJBaculovirus200ugQuote
MP499533FMJMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus equi subsp. zooepidemicus (strain H70)
UniProt IDC0MGL2
Gene NameLocus:SZO_10960
Protein NameUPF0342 protein SZO_10960
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMSQDIYDYANKLERAVRALPEYRKALEAREEIKADEAASQLFDEFVAVQEKLQGLMQTGQ LPTETEQADIQALSQKIEANDLLKGYFNAQQALSIYVNDIERIVFAPLKDLAK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review