Request QuoteCatalog Number: xP494726FMYSize: 0.2-1mg

Request Quote

Recombinant UPF0342 protein SPN23F13380 (SPN23F13380)

Recombinant UPF0342 protein SPN23F13380 (SPN23F13380) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP494726FMYYeast1mgQuote
EP494726FMYE. coli1mgQuote
BP494726FMYBaculovirus200ugQuote
MP494726FMYMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
UniProt IDB8ZKM1
Gene NameLocus:SPN23F13380
Protein NameUPF0342 protein SPN23F13380
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMSNIYDSANELSRGLRGLPEYKAVKAAKDAIAADAEASKIFTEYLAFQEEIQKLAHTGQM PDASFQAKMEGFGKQIQGNSLLSEFFTKQQQLAIYLSDIEKIVFEPVSELLK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review