Request QuoteCatalog Number: xP421198FMNSize: 0.2-1mg

Request Quote

Recombinant UPF0342 protein SGO_1370 (SGO_1370)

Recombinant UPF0342 protein SGO_1370 (SGO_1370) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP421198FMNYeast1mgQuote
EP421198FMNE. coli1mgQuote
BP421198FMNBaculovirus200ugQuote
MP421198FMNMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288)
UniProt IDA8AXZ1
Gene NameLocus:SGO_1370
Protein NameUPF0342 protein SGO_1370
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMSNIYDLANELNRTFRELPEYKAVLESKAAIDADSEAKSLFDDYIAFQGKIQQLMQTGQM PTPELQEEMKSFGEKIQANAIVTEFFTKQQQLSVYLSDIERIVFEPIQDLMK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review