Request QuoteCatalog Number: xP496163FMISize: 0.2-1mg

Request Quote

Recombinant UPF0342 protein SEQ_0993 (SEQ_0993)

Recombinant UPF0342 protein SEQ_0993 (SEQ_0993) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP496163FMIYeast1mgQuote
EP496163FMIE. coli1mgQuote
BP496163FMIBaculovirus200ugQuote
MP496163FMIMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus equi subsp. equi (strain 4047)
UniProt IDC0M8U0
Gene NameLocus:SEQ_0993
Protein NameUPF0342 protein SEQ_0993
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMSQDIYDYANKLERAVRALPEYRKALEAREEIKADEAASQLFDEFVAVQEKLQGLMQTGQ LPTETEQADIQALSQKIEANDLLKGYFNAQQALSVYVNDIERIVFAPLKDLAK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review