Request QuoteCatalog Number: xP421335BOLSize: 0.2-1mg

Request Quote

Recombinant UPF0342 protein BPUM_0928 (BPUM_0928)

Recombinant UPF0342 protein BPUM_0928 (BPUM_0928) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP421335BOLYeast1mgQuote
EP421335BOLE. coli1mgQuote
BP421335BOLBaculovirus200ugQuote
MP421335BOLMammalian Cell200ugQuote

Protein Information

SpeciesBacillus pumilus (strain SAFR-032)
UniProt IDA8FBJ5
Gene NameLocus:BPUM_0928
Protein NameUPF0342 protein BPUM_0928
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMSVNVYDVAYDLEKALRHSEEYSTLKNLYDEVNADESSKRMFENFRDIQVNLQQKQMTGQ EITQEEVEQAQKTVALVQQHDKISQLMEAEQRVSVLIGELNKVIMKPLEELYGNPEEN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review