Request QuoteCatalog Number: xP524795FGJSize: 0.2-1mg

Request Quote

Recombinant UPF0339 protein in ptx operon 5'region

Recombinant UPF0339 protein in ptx operon 5'region can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP524795FGJYeast1mgQuote
EP524795FGJE. coli1mgQuote
BP524795FGJBaculovirus200ugQuote
MP524795FGJMammalian Cell200ugQuote

Protein Information

SpeciesPseudomonas stutzeri (Pseudomonas perfectomarina)
UniProt IDO69049
Gene Name
Protein NameUPF0339 protein in ptx operon 5'region
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceMSGTFEIYNDKAGEFRFRLKANNGQAILASEGYKDKSGCLNGVESVKKNAPDDARYERKA SGADKFMFNLKAGNHQVVGTSQSYASEASRDKGIESVKNHAPDAKVVEVGN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review