Request QuoteCatalog Number: xP426469TKESize: 0.2-1mg

Request Quote

Recombinant UPF0296 protein Tlet_1629 (Tlet_1629)

Recombinant UPF0296 protein Tlet_1629 (Tlet_1629) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP426469TKEYeast1mgQuote
EP426469TKEE. coli1mgQuote
BP426469TKEBaculovirus200ugQuote
MP426469TKEMammalian Cell200ugQuote

Protein Information

SpeciesThermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / TMO)
UniProt IDA8F7P9
Gene NameLocus:Tlet_1629
Protein NameUPF0296 protein Tlet_1629
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMYGLINIGFGNVISGDRVIAIVNPESAPLKRLKDEAKDEGKLIDATYGRKTRAILITDSN HIILSAIQPETIAQRFKQSMIEIEENLNKVR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review