Request QuoteCatalog Number: xP427817DHWSize: 0.2-1mg

Request Quote

Recombinant UPF0296 protein Dole_1911 (Dole_1911)

Recombinant UPF0296 protein Dole_1911 (Dole_1911) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP427817DHWYeast1mgQuote
EP427817DHWE. coli1mgQuote
BP427817DHWBaculovirus200ugQuote
MP427817DHWMammalian Cell200ugQuote

Protein Information

SpeciesDesulfococcus oleovorans (strain DSM 6200 / Hxd3)
UniProt IDA8ZSH8
Gene NameLocus:Dole_1911
Protein NameUPF0296 protein Dole_1911
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMHRKNLLNIGFGNRIVAEDIIAVVSPASAPVKRMKDEAKKAGRLVDATQGRKTRSVIVMA SNHVILSAIHTETISQRFAAINGNRLGPDDDPDLMPE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review