Request QuoteCatalog Number: xP489195SYSSize: 0.2-1mg

Request Quote

Recombinant UPF0267 protein Sbal223_1827 (Sbal223_1827)

Recombinant UPF0267 protein Sbal223_1827 (Sbal223_1827) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP489195SYSYeast1mgQuote
EP489195SYSE. coli1mgQuote
BP489195SYSBaculovirus200ugQuote
MP489195SYSMammalian Cell200ugQuote

Protein Information

SpeciesShewanella baltica (strain OS223)
UniProt IDB8E759
Gene NameLocus:Sbal223_1827
Protein NameUPF0267 protein Sbal223_1827
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMLLSKITFFERFEHDILSGTKTITLRDEAESHVITGQILPVSTFETDRWFCDIQIIDVTP VKLTELTEVHAKQENMTLPQLCDVIAEIYPGLEQLFMIRFRILSQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review