Request QuoteCatalog Number: xP509953ENUSize: 0.2-1mg

Request Quote

Recombinant UPF0265 protein yeeX (yeeX)

Recombinant UPF0265 protein yeeX (yeeX) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP509953ENUYeast1mgQuote
EP509953ENUE. coli1mgQuote
BP509953ENUBaculovirus200ugQuote
MP509953ENUMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12 / MC4100 / BW2952)
UniProt IDC4ZQR6
Gene NameyeeX; Locus:BWG_1797
Protein NameUPF0265 protein yeeX
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMETTKPSFQDVLEFVRLFRRKNKLQREIQDVEKKIRDNQKRVLLLDNLSDYIKPGMSVEA IQGIIASMKGDYEDRVDDYIIKNAELSKERRDISKKLKAMGEMKNGEAK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review