Request QuoteCatalog Number: xP492282BWYSize: 0.2-1mg

Request Quote

Recombinant UPF0265 protein BUAP5A_549 (BUAP5A_549)

Recombinant UPF0265 protein BUAP5A_549 (BUAP5A_549) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP492282BWYYeast1mgQuote
EP492282BWYE. coli1mgQuote
BP492282BWYBaculovirus200ugQuote
MP492282BWYMammalian Cell200ugQuote

Protein Information

SpeciesBuchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
UniProt IDB8D9X7
Gene NameLocus:BUAP5A_549
Protein NameUPF0265 protein BUAP5A_549
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMSDTKKSFKNVLEFVHKFRRKNKIKREISDIEKKIRDNQKRILLLDNLIQYITLDMNYEE IKKIIFMMKSDYEDRIDDYIVKNAELSKEKRNLSKELKFIIK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review