Request QuoteCatalog Number: xP489703BXASize: 0.2-1mg

Request Quote

Recombinant UPF0265 protein BUAPTUC7_550 (BUAPTUC7_550)

Recombinant UPF0265 protein BUAPTUC7_550 (BUAPTUC7_550) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP489703BXAYeast1mgQuote
EP489703BXAE. coli1mgQuote
BP489703BXABaculovirus200ugQuote
MP489703BXAMammalian Cell200ugQuote

Protein Information

SpeciesBuchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
UniProt IDB8D879
Gene NameLocus:BUAPTUC7_550
Protein NameUPF0265 protein BUAPTUC7_550
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMSDTKKSFKNVLEFVHKFRRKNKIKREISDIEKKIRDNQKRILLLDNLIQYITLDMNYEE IKKIIFMMKSDYEDRIDDYIVKNAELSKEKRNLSKELKFIIK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review