Request QuoteCatalog Number: xP455312AXISize: 0.2-1mg

Request Quote

Recombinant UPF0265 protein APP7_0751 (APP7_0751)

Recombinant UPF0265 protein APP7_0751 (APP7_0751) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP455312AXIYeast1mgQuote
EP455312AXIE. coli1mgQuote
BP455312AXIBaculovirus200ugQuote
MP455312AXIMammalian Cell200ugQuote

Protein Information

SpeciesActinobacillus pleuropneumoniae serotype 7 (strain AP76)
UniProt IDB3GXE4
Gene NameLocus:APP7_0751
Protein Name
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceMADVKKQSFQDMLDYVHLYRLKNKLHRETADNDRKIRDNQKRVLLLDNLNQYINDSMTVE DIRAIIANMRDDYENRVDDYMIRNAELSKQRREIRQKMAAHKTAASEKNEK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review