Request QuoteCatalog Number: xP489914HTDSize: 0.2-1mg

Request Quote

Recombinant UPF0263 protein HAPS_1002 (HAPS_1002)

Recombinant UPF0263 protein HAPS_1002 (HAPS_1002) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP489914HTDYeast1mgQuote
EP489914HTDE. coli1mgQuote
BP489914HTDBaculovirus200ugQuote
MP489914HTDMammalian Cell200ugQuote

Protein Information

SpeciesHaemophilus parasuis serovar 5 (strain SH0165)
UniProt IDB8F5L9
Gene NameLocus:HAPS_1002
Protein NameUPF0263 protein HAPS_1002
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMANLSPDEAIELAYDIFLEMASDNLEPADILLFNLQFEERGAVEMVETSENWEQEIGVLI DPDAFAEVWIGLINQNDEMDDIFARFLISNDAENREYHVIWKS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review