Request QuoteCatalog Number: xP488338SYWSize: 0.2-1mg

Request Quote

Recombinant UPF0251 protein swp_0615 (swp_0615)

Recombinant UPF0251 protein swp_0615 (swp_0615) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP488338SYWYeast1mgQuote
EP488338SYWE. coli1mgQuote
BP488338SYWBaculovirus200ugQuote
MP488338SYWMammalian Cell200ugQuote

Protein Information

SpeciesShewanella piezotolerans (strain WP3 / JCM 13877)
UniProt IDB8CIG1
Gene NameLocus:swp_0615
Protein NameUPF0251 protein swp_0615
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMPRPKKCRNLSCRAPYSMLKPNGIPSVELEKIHIDADEFEALNLGDVQKMSQLDAAASMG ISRQTFGYLLASARKKVATAITQGHGLVLPQSTDTKREVL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review