Request QuoteCatalog Number: xP488561SYSSize: 0.2-1mg

Request Quote

Recombinant UPF0235 protein Sbal223_1335 (Sbal223_1335)

Recombinant UPF0235 protein Sbal223_1335 (Sbal223_1335) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP488561SYSYeast1mgQuote
EP488561SYSE. coli1mgQuote
BP488561SYSBaculovirus200ugQuote
MP488561SYSMammalian Cell200ugQuote

Protein Information

SpeciesShewanella baltica (strain OS223)
UniProt IDB8E927
Gene NameLocus:Sbal223_1335
Protein NameUPF0235 protein Sbal223_1335
Region Expressed1-99
Expression Tag6xHis
Purity>90%
AA SequenceMSAVTLQQGDLLLNLYIQPKASRDQIVGLHGDELKVAITAPPIDGKANAHLSKYLAKTFK VPKSDIHIMKGELGRHKQIRVIDPKIIPSVITELMGQTS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review