Request QuoteCatalog Number: xP488629HTDSize: 0.2-1mg

Request Quote

Recombinant UPF0235 protein HAPS_1504 (HAPS_1504)

Recombinant UPF0235 protein HAPS_1504 (HAPS_1504) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP488629HTDYeast1mgQuote
EP488629HTDE. coli1mgQuote
BP488629HTDBaculovirus200ugQuote
MP488629HTDMammalian Cell200ugQuote

Protein Information

SpeciesHaemophilus parasuis serovar 5 (strain SH0165)
UniProt IDB8F6W0
Gene NameLocus:HAPS_1504
Protein NameUPF0235 protein HAPS_1504
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMQAVEFCENPQGIRLRIFLQPKASRDQIVGLHDNELKIAITAPPIDGQANAHLLKYLSKL FKVPKSSIVLEKGELQRHKQIFVPEPKLIPKEIEVLG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review