Request QuoteCatalog Number: xP457314DQYSize: 0.2-1mg

Request Quote

Recombinant UPF0235 protein CJA_0091 (CJA_0091)

Recombinant UPF0235 protein CJA_0091 (CJA_0091) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP457314DQYYeast1mgQuote
EP457314DQYE. coli1mgQuote
BP457314DQYBaculovirus200ugQuote
MP457314DQYMammalian Cell200ugQuote

Protein Information

SpeciesCellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa)
UniProt IDB3PFH5
Gene NameLocus:CJA_0091
Protein Name
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMVGQAGHYRWQGEDLILHCQLQPKASGDDIVGVHGDRLKIRITAPPVDGKANEYLIKWLS KQFRVPKGNIKILQGELGRHKTLGIHAPRHLPEEAHICFPK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review