Request QuoteCatalog Number: xP494941MVOSize: 0.2-1mg

Request Quote

Recombinant UPF0233 membrane protein MLBr00013 (MLBr00013)

Recombinant UPF0233 membrane protein MLBr00013 (MLBr00013) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP494941MVOYeast1mgQuote
EP494941MVOE. coli1mgQuote
BP494941MVOBaculovirus200ugQuote
MP494941MVOMammalian Cell200ugQuote

Protein Information

SpeciesMycobacterium leprae (strain Br4923)
UniProt IDB8ZTP9
Gene NameLocus:MLBr00013
Protein NameUPF0233 membrane protein MLBr00013
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMPKSKVRKKNDFTITSVSRTPVKVKVGPSSVWFVTLFVGLMLIGLVWLMVFQLAALGTQA PTALHWMAQLGPWNYAIAFAFMITGLLLTMRWH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review