Request QuoteCatalog Number: xP511486ENUSize: 0.2-1mg

Request Quote

Recombinant UPF0231 protein yacL (yacL)

Recombinant UPF0231 protein yacL (yacL) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP511486ENUYeast1mgQuote
EP511486ENUE. coli1mgQuote
BP511486ENUBaculovirus200ugQuote
MP511486ENUMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12 / MC4100 / BW2952)
UniProt IDC4ZRL2
Gene NameyacL; Locus:BWG_0112
Protein NameUPF0231 protein yacL
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMDYEFLRDITGVVKVRMSMGHEVVGHWFNEEVKENLALLDEVEQAAHALKGSERSWQRAG HEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVEDFLQVVAAYRNFVQQK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review