Request QuoteCatalog Number: xP499529FMJSize: 0.2-1mg

Request Quote

Recombinant UPF0223 protein SZO_10560 (SZO_10560)

Recombinant UPF0223 protein SZO_10560 (SZO_10560) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP499529FMJYeast1mgQuote
EP499529FMJE. coli1mgQuote
BP499529FMJBaculovirus200ugQuote
MP499529FMJMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus equi subsp. zooepidemicus (strain H70)
UniProt IDC0MG79
Gene NameLocus:SZO_10560
Protein NameUPF0223 protein SZO_10560
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMSDHYHYPLDVSWSTEEITSVLHFLNQVELAYEAKVGAEELLKSYAAYKEIVRSKSQEKQ IDREFQQASGYSTYQAVKKAREIEKGFFSLGR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review