Request QuoteCatalog Number: xP382800SUQSize: 0.2-1mg

Request Quote

Recombinant UPF0223 protein SpyM50840 (SpyM50840)

Recombinant UPF0223 protein SpyM50840 (SpyM50840) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP382800SUQYeast1mgQuote
EP382800SUQE. coli1mgQuote
BP382800SUQBaculovirus200ugQuote
MP382800SUQMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus pyogenes serotype M5 (strain Manfredo)
UniProt IDA2RE93
Gene NameLocus:SpyM50840
Protein NameUPF0223 protein SpyM50840
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMSGNYYYPLDLSWSTEEISSVLHFLNKVELAYEKKVDAKQLLDSYKTYKTIVKSKAQEKQ IDRDFQKVSGYSTYQVVKKAKAIEKGFFSLGN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review