Request QuoteCatalog Number: xP497589FMISize: 0.2-1mg

Request Quote

Recombinant UPF0223 protein SEQ_1039 (SEQ_1039)

Recombinant UPF0223 protein SEQ_1039 (SEQ_1039) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP497589FMIYeast1mgQuote
EP497589FMIE. coli1mgQuote
BP497589FMIBaculovirus200ugQuote
MP497589FMIMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus equi subsp. equi (strain 4047)
UniProt IDC0M990
Gene NameLocus:SEQ_1039
Protein NameUPF0223 protein SEQ_1039
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMSDHYHYPLDVSWSTEEITSVLHFLNQVELAYEAKVGAEELLKSYAAYKEIVRSKSQEKQ IDREFQQASGYSTYQAVKKAREIEKGFFSLGR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review