Request QuoteCatalog Number: xP492948LPWSize: 0.2-1mg

Request Quote

Recombinant UPF0223 protein LMHCC_1569 (LMHCC_1569)

Recombinant UPF0223 protein LMHCC_1569 (LMHCC_1569) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP492948LPWYeast1mgQuote
EP492948LPWE. coli1mgQuote
BP492948LPWBaculovirus200ugQuote
MP492948LPWMammalian Cell200ugQuote

Protein Information

SpeciesListeria monocytogenes serotype 4a (strain HCC23)
UniProt IDB8DCF0
Gene NameLocus:LMHCC_1569
Protein NameUPF0223 protein LMHCC_1569
Region Expressed1-90
Expression Tag6xHis
Purity>90%
AA SequenceMEYSYPLNPDWTTEEMTIVVQFLEAIERAYEKGIDTQELKDKYRAFKHVVPAKGEEKRIG IDFEKASGYSAYKVMQLVKNATTSKIKMQP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review