Request QuoteCatalog Number: xP381707LNDSize: 0.2-1mg

Request Quote

Recombinant UPF0223 protein llmg_0515 (llmg_0515)

Recombinant UPF0223 protein llmg_0515 (llmg_0515) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP381707LNDYeast1mgQuote
EP381707LNDE. coli1mgQuote
BP381707LNDBaculovirus200ugQuote
MP381707LNDMammalian Cell200ugQuote

Protein Information

SpeciesLactococcus lactis subsp. cremoris (strain MG1363)
UniProt IDA2RIM4
Gene NameLocus:llmg_0515
Protein NameUPF0223 protein llmg_0515
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMKENYNYPLDLSWSTTEMTEVLSFFNQVEKFYESKVEKELFLESYAAFKKVVPSKMQEKQ LGRDFEQSSGYSLYRALKEVEASGKRFVSADKA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review