Request QuoteCatalog Number: xP512589ENUSize: 0.2-1mg

Request Quote

Recombinant UPF0213 protein yhbQ (yhbQ)

Recombinant UPF0213 protein yhbQ (yhbQ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP512589ENUYeast1mgQuote
EP512589ENUE. coli1mgQuote
BP512589ENUBaculovirus200ugQuote
MP512589ENUMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12 / MC4100 / BW2952)
UniProt IDC4ZSP6
Gene NameyhbQ; Locus:BWG_2859
Protein NameUPF0213 protein yhbQ
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMTPWFLYLIRTADNKLYTGITTDVERRYQQHQSGKGAKALRGKGELTLVFSAPVGDRSLA LRAEYRVKQLTKRQKERLVAEGAGFAELLSSLQTPEIKSD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review