Request QuoteCatalog Number: xP381638SUQSize: 0.2-1mg

Request Quote

Recombinant UPF0213 protein SpyM50708 (SpyM50708)

Recombinant UPF0213 protein SpyM50708 (SpyM50708) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP381638SUQYeast1mgQuote
EP381638SUQE. coli1mgQuote
BP381638SUQBaculovirus200ugQuote
MP381638SUQMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus pyogenes serotype M5 (strain Manfredo)
UniProt IDA2RDW6
Gene NameLocus:SpyM50708
Protein NameUPF0213 protein SpyM50708
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMTTKKAYMYVLECADKTLYTGYTTDLKKRLATHNAGKGAKYTRYRLPVSLLYYEVFDSKE AAMSAEALFKKRKTRSQKLAYIATHQKEKKNH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review