Request QuoteCatalog Number: xP383257LNDSize: 0.2-1mg

Request Quote

Recombinant UPF0213 protein llmg_2010 (llmg_2010)

Recombinant UPF0213 protein llmg_2010 (llmg_2010) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP383257LNDYeast1mgQuote
EP383257LNDE. coli1mgQuote
BP383257LNDBaculovirus200ugQuote
MP383257LNDMammalian Cell200ugQuote

Protein Information

SpeciesLactococcus lactis subsp. cremoris (strain MG1363)
UniProt IDA2RMP4
Gene NameLocus:llmg_2010
Protein NameUPF0213 protein llmg_2010
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMNTHFTYVLQCADQTLYCGYTTDLEKRLATHNSGKGAKYTKTRLPVKLLASVNFDNKNDA MSCEWWFKHKLVRQQKLKLIKNNLIKEKFLEYLLAKQK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review