Request QuoteCatalog Number: xP385998MNTSize: 0.2-1mg

Request Quote

Recombinant UPF0212 protein Mlab_0931 (Mlab_0931)

Recombinant UPF0212 protein Mlab_0931 (Mlab_0931) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP385998MNTYeast1mgQuote
EP385998MNTE. coli1mgQuote
BP385998MNTBaculovirus200ugQuote
MP385998MNTMammalian Cell200ugQuote

Protein Information

SpeciesMethanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
UniProt IDA2SRZ6
Gene NameLocus:Mlab_0931
Protein NameUPF0212 protein Mlab_0931
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMSDYRVTLEAGWTVKDVESVQDAIGIAVSEAGKRLHPSAKFVDVDVMNMPCPYCGKEINT ALVIARTGLVGLLLSMKVFKAENPEHAVHIAKSVIGRALRDVSLSTYSVELIEGDEIAE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review