Request QuoteCatalog Number: xP490304DJTSize: 0.2-1mg

Request Quote

Recombinant UPF0147 protein DKAM_0139 (DKAM_0139)

Recombinant UPF0147 protein DKAM_0139 (DKAM_0139) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP490304DJTYeast1mgQuote
EP490304DJTE. coli1mgQuote
BP490304DJTBaculovirus200ugQuote
MP490304DJTMammalian Cell200ugQuote

Protein Information

SpeciesDesulfurococcus kamchatkensis (strain 1221n / DSM 18924)
UniProt IDB8D355
Gene NameLocus:DKAM_0139
Protein NameUPF0147 protein DKAM_0139
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMELSRVLDNEVKLRNAIYLLMSIVNDTAVPRNIRRAATEALNYLRDERYTPGVRAANAVG VLDQVSQDPNMPLSARTKVWQVIAILETIHD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review