Request QuoteCatalog Number: xP492318LPWSize: 0.2-1mg

Request Quote

Recombinant UPF0145 protein LMHCC_2435 (LMHCC_2435)

Recombinant UPF0145 protein LMHCC_2435 (LMHCC_2435) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP492318LPWYeast1mgQuote
EP492318LPWE. coli1mgQuote
BP492318LPWBaculovirus200ugQuote
MP492318LPWMammalian Cell200ugQuote

Protein Information

SpeciesListeria monocytogenes serotype 4a (strain HCC23)
UniProt IDB8DGL7
Gene NameLocus:LMHCC_2435
Protein NameUPF0145 protein LMHCC_2435
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGGRSQGYEDELINAREE AIREMEQRAKDIGANAVIGVDIDYEVLGADNGMLMVTASGTAVVIEAQDY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review