Request QuoteCatalog Number: xP488664DJJSize: 0.2-1mg

Request Quote

Recombinant UPF0145 protein Dhaf_3855 (Dhaf_3855)

Recombinant UPF0145 protein Dhaf_3855 (Dhaf_3855) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP488664DJJYeast1mgQuote
EP488664DJJE. coli1mgQuote
BP488664DJJBaculovirus200ugQuote
MP488664DJJMammalian Cell200ugQuote

Protein Information

SpeciesDesulfitobacterium hafniense (strain DCB-2 / DSM 10664)
UniProt IDB8FS83
Gene NameLocus:Dhaf_3855
Protein NameUPF0145 protein Dhaf_3855
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMIVTTTPNIDGRKIQNYYGIVTGEAIMGANVVRDIFAGITDIIGGRSGAYEEKLQDARQI ALKEMEQNAARMGANAVVGVDIDYEVVGQSGSMLMVSASGTAVTVV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review