Request QuoteCatalog Number: xP464995AXISize: 0.2-1mg

Request Quote

Recombinant UPF0145 protein APP7_0542 (APP7_0542)

Recombinant UPF0145 protein APP7_0542 (APP7_0542) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP464995AXIYeast1mgQuote
EP464995AXIE. coli1mgQuote
BP464995AXIBaculovirus200ugQuote
MP464995AXIMammalian Cell200ugQuote

Protein Information

SpeciesActinobacillus pleuropneumoniae serotype 7 (strain AP76)
UniProt IDB3GX42
Gene NameLocus:APP7_0542
Protein Name
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMIITTTPTIDGHQITEYKGLVFGEVVSGANFIRDFFASITDVIGGRSGAYESKLNSARQE ALAELEKEAKRVGANALVGVSMEYQSMGGDKGMFIVVATGTAVVIR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review