Request QuoteCatalog Number: xP505791SWUSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein ybaB (ybaB)

Recombinant UPF0133 protein ybaB (ybaB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP505791SWUYeast1mgQuote
EP505791SWUE. coli1mgQuote
BP505791SWUBaculovirus200ugQuote
MP505791SWUMammalian Cell200ugQuote

Protein Information

SpeciesSalmonella paratyphi C (strain RKS4594)
UniProt IDC0Q809
Gene NameybaB; Locus:SPC_0499
Protein NameUPF0133 protein ybaB
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPS LLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review