Request QuoteCatalog Number: xP508494FMJSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein SZO_16661 (SZO_16661)

Recombinant UPF0133 protein SZO_16661 (SZO_16661) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP508494FMJYeast1mgQuote
EP508494FMJE. coli1mgQuote
BP508494FMJBaculovirus200ugQuote
MP508494FMJMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus equi subsp. zooepidemicus (strain H70)
UniProt IDC0MEQ5
Gene NameLocus:SZO_16661
Protein NameUPF0133 protein SZO_16661
Region Expressed1-99
Expression Tag6xHis
Purity>90%
AA SequenceMMNMQNMMKQAQKLQKQMEQKQADLAATSFSGKSAQELVTATFTGDKRLVNITFKEAVVD PEDIETLQDMTTQAINDALTQIDEATKKSLGAFAGKLPF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review