Request QuoteCatalog Number: xP492183SYWSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein swp_1717 (swp_1717)

Recombinant UPF0133 protein swp_1717 (swp_1717) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP492183SYWYeast1mgQuote
EP492183SYWE. coli1mgQuote
BP492183SYWBaculovirus200ugQuote
MP492183SYWMammalian Cell200ugQuote

Protein Information

SpeciesShewanella piezotolerans (strain WP3 / JCM 13877)
UniProt IDB8CMY7
Gene NameLocus:swp_1717
Protein NameUPF0133 protein swp_1717
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMFGKGGMGNLMKQAQQMQDKMAKVQEEIARMEVTGEAGAGLVKVTMTGSHSVRKVDIDAS LLEDDKEMLEDLIAAACNDAARRVEENQKDKMAEVTGGMQLPPGMKMPF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review