Request QuoteCatalog Number: xP494008FMYSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein SPN23F10240 (SPN23F10240)

Recombinant UPF0133 protein SPN23F10240 (SPN23F10240) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP494008FMYYeast1mgQuote
EP494008FMYE. coli1mgQuote
BP494008FMYBaculovirus200ugQuote
MP494008FMYMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
UniProt IDB8ZPU7
Gene NameLocus:SPN23F10240
Protein NameUPF0133 protein SPN23F10240
Region Expressed1-99
Expression Tag6xHis
Purity>90%
AA SequenceMMNMQNMMRQAQKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVD PEDLETLSDMTVQAINSALEQIDETTKKKLGAFAGKLPF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review