Request QuoteCatalog Number: xP495691FMISize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein SEQ_0368 (SEQ_0368)

Recombinant UPF0133 protein SEQ_0368 (SEQ_0368) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP495691FMIYeast1mgQuote
EP495691FMIE. coli1mgQuote
BP495691FMIBaculovirus200ugQuote
MP495691FMIMammalian Cell200ugQuote

Protein Information

SpeciesStreptococcus equi subsp. equi (strain 4047)
UniProt IDC0MA08
Gene NameLocus:SEQ_0368
Protein NameUPF0133 protein SEQ_0368
Region Expressed1-99
Expression Tag6xHis
Purity>90%
AA SequenceMMNMQNMMKQAQKLQKQMEQKQADLAAMQFTGKSAQELVTATFTGDKQLVSIDFKEAVVD PEDIETLQDMTAQAINAALAQIDEATKKTLGAFAGKLPF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review