Request QuoteCatalog Number: xP508749RLKSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein RER_03900 (RER_03900)

Recombinant UPF0133 protein RER_03900 (RER_03900) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP508749RLKYeast1mgQuote
EP508749RLKE. coli1mgQuote
BP508749RLKBaculovirus200ugQuote
MP508749RLKMammalian Cell200ugQuote

Protein Information

SpeciesRhodococcus erythropolis (strain PR4 / NBRC 100887)
UniProt IDC0ZN46
Gene NameLocus:RER_03900
Protein NameUPF0133 protein RER_03900
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMQPGGAPDMSALLAQAQQMQQQLMAAQQEMAQAEVTGQAGGGLVVATVKGTGEVVGLQID PKVVDPEDVETLQDLVIGAIEDASRKAQEVAAEKLGPLAGGLGGGLPGLPGF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review