Request QuoteCatalog Number: xP453609DZSSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein RALTA_A1934 (RALTA_A1934)

Recombinant UPF0133 protein RALTA_A1934 (RALTA_A1934) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP453609DZSYeast1mgQuote
EP453609DZSE. coli1mgQuote
BP453609DZSBaculovirus200ugQuote
MP453609DZSMammalian Cell200ugQuote

Protein Information

SpeciesCupriavidus taiwanensis (strain R1 / LMG 19424) (Ralstonia taiwanensis (strain LMG 19424) )
UniProt IDB3R1M7
Gene NameLocus:RALTA_A1934
Protein Name
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMMKGQLAGLMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVVMTCKNDVKRVTIDPSL LAEGEDKDLLEDLVAAAFNDAVRKAEATTQEKMGSMTSGLPLPPGFKLPF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review