Request QuoteCatalog Number: xP506524EUASize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein PERMA_0533 (PERMA_0533)

Recombinant UPF0133 protein PERMA_0533 (PERMA_0533) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP506524EUAYeast1mgQuote
EP506524EUAE. coli1mgQuote
BP506524EUABaculovirus200ugQuote
MP506524EUAMammalian Cell200ugQuote

Protein Information

SpeciesPersephonella marina (strain DSM 14350 / EX-H1)
UniProt IDC0QUF7
Gene NameLocus:PERMA_0533
Protein NameUPF0133 protein PERMA_0533
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMFNLGNLGEMMKMMKSMQENIEKAKEELRKEEIVVEVGGGMVKVILNGLGEIKDVLIDKT LLTEDNHEILQDLLVAAFNEANRRTKEVMGEKMTQAAGLPSNIPGLGNLF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review