Request QuoteCatalog Number: xP489243MTFSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein Msil_0275 (Msil_0275)

Recombinant UPF0133 protein Msil_0275 (Msil_0275) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP489243MTFYeast1mgQuote
EP489243MTFE. coli1mgQuote
BP489243MTFBaculovirus200ugQuote
MP489243MTFMammalian Cell200ugQuote

Protein Information

SpeciesMethylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906)
UniProt IDB8EP16
Gene NameLocus:Msil_0275
Protein NameUPF0133 protein Msil_0275
Region Expressed1-107
Expression Tag6xHis
Purity>90%
AA SequenceMRDMLGLMKQAQAMQEKIQQMQAEIERLEVEGQSGGGMVRVTLSAKGQLRNLAIDDQLIK ADEKQILEDLIITAHEDARKKAERLMEEKMQGVTAGLALPPGMKLPF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review