Request QuoteCatalog Number: xP494027MVOSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein MLBr02330 (MLBr02330)

Recombinant UPF0133 protein MLBr02330 (MLBr02330) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP494027MVOYeast1mgQuote
EP494027MVOE. coli1mgQuote
BP494027MVOBaculovirus200ugQuote
MP494027MVOMammalian Cell200ugQuote

Protein Information

SpeciesMycobacterium leprae (strain Br4923)
UniProt IDB8ZT20
Gene NameLocus:MLBr02330
Protein NameUPF0133 protein MLBr02330
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSGEVVSVAIDPK VVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAMRPTAPPPTPPTYMAGT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review