Request QuoteCatalog Number: xP488450LPWSize: 0.2-1mg

Request Quote

Recombinant UPF0133 protein LMHCC_2831 (LMHCC_2831)

Recombinant UPF0133 protein LMHCC_2831 (LMHCC_2831) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP488450LPWYeast1mgQuote
EP488450LPWE. coli1mgQuote
BP488450LPWBaculovirus200ugQuote
MP488450LPWMammalian Cell200ugQuote

Protein Information

SpeciesListeria monocytogenes serotype 4a (strain HCC23)
UniProt IDB8DAT8
Gene NameLocus:LMHCC_2831
Protein NameUPF0133 protein LMHCC_2831
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMRGMGNMQGMMKQMQKMQKEMAKAQADLEAQEFTGTAGGGMVTVKATGKRVITDVVINEE VVDPEDIEMLQDLVLAATNDVLKQIEDTTSQTMGKFTQGLNIPGM
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review